Recombinant Mouse Midkine/MDK Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02865-10, RP02865-20, RP02865-50, RP02865-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Midkine/MDK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys23-Asp140) of mouse Midkine (Accession #NP_001012335.1) fused with no additional amino acid.
Alternate Names: MK; ARAP; MDK; MEK; MK1; MKARAP; NEGF2
SWISS: P12025
GeneID: 17242
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Midkine is a heparin-binding growth factor, originally reported as the product of a retinoic acid-responsive gene during embryogenesis, but currently viewed as a multifaceted factor contributing to both normal tissue homeostasis and disease development. Midkine is abnormally expressed at high levels in various human malignancies and acts as a mediator for the acquisition of critical hallmarks of cancer, including cell growth, survival, metastasis, migration, and angiogenesis.
Source: E. coli
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only