WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse MUP-1 Protein - RP01588LQ

Recombinant Mouse MUP-1 Protein - RP01588LQ

Regular price
$182.00
Regular price
Sale price
$182.00
Unit price
per 
Availability
Sold out

Recombinant Mouse MUP-1 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01588LQ-10, RP01588LQ-20, RP01588LQ-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse MUP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Glu180) of mouse MUP-1 (Accession #NP_001186924.1) fused with a 6×His tag at the C-terminus.

Alternate Names: Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1, MUP1, Major urinary protein 1, Mup7, Up-1, Ltn-1, Mup-1, Mup-a, Mup10, Lvtn-1, MUP1

SWISS: P11588

GeneID: 17840

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.

Background: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Source: HEK293 cells

Tag: C-His

Formulation: Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Antigen Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only