WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse NKp46/NCR1/CD335 Protein - RP01525

Recombinant Mouse NKp46/NCR1/CD335 Protein - RP01525

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse NKp46/NCR1/CD335 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01525-10, RP01525-20, RP01525-50, RP01525-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse NKp46/NCR1/CD335 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln17-Asn255) of mouse NCR1/CD335 (Accession #NP_034876.2) fused with a raFc tag at the C-terminus.

Alternate Names: Ly94, NKp46, Ncr1

SWISS: Q8C567

GeneID: 17086

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: NCR1, also known as NK-p46 and CD335, is a natural cytotoxicity receptor(NCR). NCRs are type I transmembrane proteins with 1-2 extracellular immunoglobulin domains, a transmembrane domain containing a positively charged amino acid residue, and a short cytoplasmic tail. All are expressed almost exclusively by NK cells and play a major role in triggering NK-mediated killing of most tumor cell lines. NKp46 has two extracellular Ig-like domains followed by a ~40 residue stalk region, a type I transmembrane domain, and a short cytoplasmic tail. NKp46 has been implicated in NK cell-mediated lysis of several autologous tumor cells, pathogen-infected cell lines, and mononuclear phagocytes infected with an intracellular bacterium.

Source: HEK293 cells

Tag: C-Rabbit Fc

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only