WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Oncostatin-M/OSM Protein - RP01639

Recombinant Mouse Oncostatin-M/OSM Protein - RP01639

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Oncostatin-M/OSM Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01639-10, RP01639-20, RP01639-50, RP01639-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Oncostatin-M/OSM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Arg 206) of mouse Oncostatin-M/OSM (Accession #NP_001013383.1.) fused with and a 6×His tag at the C-terminus.

Alternate Names: OncoM; OSM

SWISS: P53347

GeneID: 18413

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: OSM is a pleiotropic cytokine that initiates its biological activities by binding to specific cell surface receptors. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: MQTRLLRTLLSLTLSLLILSMALANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only