Recombinant Mouse Oncostatin-M/OSM Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01639-10, RP01639-20, RP01639-50, RP01639-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Oncostatin-M/OSM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met 1-Arg 206) of mouse Oncostatin-M/OSM (Accession #NP_001013383.1.) fused with and a 6×His tag at the C-terminus.
Alternate Names: OncoM; OSM
SWISS: P53347
GeneID: 18413
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: OSM is a pleiotropic cytokine that initiates its biological activities by binding to specific cell surface receptors. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIFR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: MQTRLLRTLLSLTLSLLILSMALANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only