Recombinant Mouse Orosomucoid-1/ORM1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01968-10, RP01968-20, RP01968-50, RP01968-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse Orosomucoid-1/ORM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-207Ala) of Mouse Orosomucoid-1/ORM1(Accession #NP_032794.1) fused with His at the C-terminus.
Alternate Names: Orm1, Agp1, Orm-1, Agp-1, Agp-2, Orm-1, Alpha-1-acid glycoprotein 1, AGP 1, Orosomucoid-1 (OMD 1)
SWISS: Q60590
GeneID: 18405
Species: Mouse
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Orosomucoid-1/ORM1 as a transport protein in the blood stream. Binds various ligands in the interior of its beta-barrel domain ,Appears to function in modulating the activity of the immune system during the acute-phase reaction
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only