Recombinant Mouse PPIase A/PPIA Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01609LQ-10, RP01609LQ-20, RP01609LQ-50, RP01609LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu164) of mouse PPIase A/PPIA (Accession #NP_032933.1) fused with a 6×His tag at the C-terminus.
Alternate Names: CYPA, CYPH, HEL-S-69p, PPIA
SWISS: P17742
GeneID: 268373
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
Source: E. coli
Tag: C-His
Formulation: Supplied as a 0.22 μm filtered solution in PBS,10% glycerol,pH 7.5.
Antigen Sequence: MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only