Recombinant Mouse PVR/CD155 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01557-10, RP01557-20, RP01557-50, RP01557-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse PVR/CD155 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp29-Leu348) of mouse PVR/CD155 (Accession #NP_081790.1) fused with a Fc, Avi tag at the C-terminus.
Alternate Names: CD155, HVED, Necl-5, NECL5, PVS, TAGE4, PVR, CD155, HVED, Necl-5, NECL5, PVS, TAGE4, PVR
SWISS: Q8K094
GeneID: 52118
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: The recombinant human PVR consists of 323 amino acids with a molecular weight of 35.1 kDa.CD155 is also known as PVR (poliovirus receptor) and Necl-5 (nectin-like molecule-5) It is a type I transmembrane single-span glycoprotein belonging to the nectins and nectin-like (Necl) subfamily. CD155/PVR was originally isolated based on its ability to mediate polio virus attachment to host cells. CD155 may assist in an efficient humoral immune response generated within the intestinal immune system.Commonly known as Poliovirus Receptor (PVR) due to its involvement in the cellular poliovirus infection in primates. It has been demonstrated that CD155 can be recognized and bond by DNAM-1 and CD96 which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse CD155 at 2 μg/mL (100 μL/well) can bind Mouse TIGIT with a linear range of 0.3-4.27 ng/mL.
Source: HEK293 cells
Tag: C-hFc&Avi
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHL
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only