Recombinant Mouse/Rat Flt4 ligand/VEGF-C Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP02804-10, RP02804-20, RP02804-50, RP02804-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse/Rat VEGF-C Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala108-Arg223) of mouse/rat VEGF-C (Accession #NP_033532.1) fused with a 6×His tag at the C-terminus.
Alternate Names: VEGFC, Flt4-L, LMPH1D, VRP; VEGF-C
SWISS: P97953
GeneID: 22341
Species: Mouse/Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Vascular endothelial growth factor C (VEGF-C) is a member of the VEGF family. Upon biosynthesis, VEGF-C protein is secreted as a non-covalent momodimer in an anti-parellel fashion. VEGF-C protein is a dimeric glycoprotein, as a ligand for two receptors, VEGFR-3 (Flt4), and VEGFR-2. VEGF-C may function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis. VEGF-C protein is over-expressed in various human cancers including breast cancer and prostate cancer. VEGF-C/VEGFR-3 axis, through different signaling pathways, plays a critical role in cancer progression by regulating different cellular functions, such as invasion, proliferation, and resistance to chemotherapy. Thus, targeting the VEGF-C/VEGFR-3 axis may be therapeutically significant for certain types of tumors.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse/Rat VEGF-C (Catalog: RP02804) at 2 μg/mL (100 μL/well) can bind Human VEGFR-3/FLT-4 (Catalog: RP00123) with a linear range of 0.0085-7.49 ng/mL.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only