Recombinant Mouse/Rat Mature TGF-beta 1 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP00671-10, RP00671-20, RP00671-50, RP00671-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TGF-beta 1/TGFB1 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of mouse TGF-beta 1/TGFB1 (Accession #P04202).
Alternate Names: TGF-beta1, Tgfb, Tgfb-1, TGFbeta1, CED, DPD1, LAP, TGFB, TGFbeta, TGFB1
SWISS: P04202
GeneID: 21803
Species: Mouse
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Transforming growth factor beta 1 (TGFβ1) is the prototype of a growing superfamily of peptide growth factorsand plays a prominent role in a variety of cellular processes, including cell-cycle progression, celldifferentiation,reproductivefunction,development,motility,adhesion,neuronalgrowth,bonemorphogenesis, wound healing, and immune surveillance. TGF- β 1, TGF- β 2 and TGF- β 3 signal via the sameheteromeric receptor complex, consisting of a ligand binding TGF- β receptor type II (T β R-II), and a TGF- βreceptor type I (T β R-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- βexpression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney,gut, liver, eye, ear, skin, and the nervous system.
Bio-Activity: Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 Mouse T cells. The ED50 for this effect is 0.054-0.214 ng/mL, corresponding to a specific activity of 4.7×10^6 ~1.85×10^7 units/mg.
Source: HEK293 cells
Tag: No tag
Formulation: Lyophilized from a 0.2 μm filtered solution of 50 mM Glycine,150 mM NaCl, pH3.5. Contact us for customized product form or formulation.
Antigen Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Endotoxin: < 0.01 EU/μg of the protein by LAL method
Research Use Only