WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse Siglec-15/CD33L3 Protein - RP01289

Recombinant Mouse Siglec-15/CD33L3 Protein - RP01289

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse Siglec-15/CD33L3 Protein

Sizes: 10ug, 20ug, 100ug

Catalogue Numbers: RP01289-10, RP01289-20, RP01289-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg24-Thr262) of mouse Siglec-15/CD33L3 (Accession #NP_001094508.1) fused with a 6×His tag at the C-terminus.

Alternate Names: sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15, sialic acid-binding Ig-like lectin 15, CD33 antigen-like 3, SIGLEC15, Siglec15, SIGLEC15

SWISS: A7E1W8

GeneID: 620235

Species: Mouse

Purity: ≥ 90 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RRDASGDLLNTEAHSAPAQRWSMQVPAEVNAEAGDAAVLPCTFTHPHRHYDGPLTAIWRSGEPYAGPQVFRCTAAPGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADSGRYFCRVEFTGDAHDRYESRHGVRLRVTAAAPRIVNISVLPGPAHAFRALCTAEGEPPPALAWSGPAPGNSSAALQGQGHGYQVTAELPALTRDGRYTCTAANSLGRAEASVYLFRFHGAPGTST

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only