Recombinant Mouse TIGIT Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01516LQ-10, RP01516LQ-20, RP01516LQ-50, RP01516LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Human TIGIT Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly26-Gly141) of human TIGIT (Accession #NP_001139797.1) fused with a mFc tag at the C-terminus.
Alternate Names: TIGIT, VSIG9, VSTM3, TIGIT, TIGIT, VSIG9, VSTM3, TIGIT
SWISS: P86176
GeneID: 100043314
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Background: TIGIT, also known as V-set and transmembrane domain-containing protein 3 (VSTM3) or V-set and immunoglobulin domain-containing protein 9 (VSIG9) is a new surface protein containing an immunoglobulin variable domain, a transmembrane domain and an immunoreceptor tyrosine-based inhibitory motif (ITIM). TIGIT is expressed on regulatory, memory, activated T cells and NK cells. It binds PVR with high affinity, and PVRL2 with lower affinity, but not PVRL3. Knockdown of TIGIT with siRNA in human memory T cells did not affect T cell responses, however, TIGIT inhibits NK cytotoxicity directly through its ITIM. TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells. The binding of PVR to TIGIT on human dendritic cells enhanced the production of IL-1 and diminished the production of IL-12p4. Also, TIGIT counter inhibits the NK-mediated killing of tumor cells and protects normal cells from NK-mediated cytotoxicity thus providing an "alternative self" mechanism for MHC class I inhibition.
Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse CD155 at 2 μg/mL (100 μL/well) can bind Mouse TIGIT with a linear range of 2-9 ng/mL.
Source: HEK293 cells
Tag: C-mFc
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSVAQFQTAPLG
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only