WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein - RP02829

Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein - RP02829

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP02829-10, RP02829-20, RP02829-50, RP02829-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse TNFSF6/FAS ligand/CD178 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro132-Leu279) of mouse Fas ligand/APTL/CD95 ligand/CD178 (Accession #AAB02915.1) fused with a 6×His tag at the N-terminus.

Alternate Names: FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A, Fas ligand, FasL, FasLG; Faslg

SWISS: P41047

GeneID: 14103

Species: Mouse

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Fas Ligand, also known as FASLG and CD95L, is the ligand for FAS. It is a transmembrane protein which binds to TNFRSF6/FAS. Interaction of FAS with fas Ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Fas Ligand may be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: PSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

Endotoxin: < 1 EU/μg of the protein by LAL method.

Research Use Only