Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01864-10, RP01864-20, RP01864-50, RP01864-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Mouse TNFSF7/CD27 Ligand/CD70 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu53-Arg195) of Mouse CD70/TNFSF7/CD27 Ligand (Accession #NP_035747.1) fused with a His tag at the N-terminus.
Alternate Names: Cd70, Cd27l, Cd27lg, Tnfsf7, CD70 antigen, CD27 ligand, CD27-L, Tumor necrosis factor ligand superfamily member 7, CD70.
SWISS: O55237
GeneID: 21948
Species: Mouse
Purity: ≥ 90% as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: CD70 is the ligand of CD27 in activated T and B lymphocytes, is an important cytokine in CD70-CD27 pathway involving with the generation and maintenance of T cell immunity. CD70 is a surface antigen, also shows antiviral activity and regulates viability of tumor cells and regulatory T cells. As for CD70 protein in mouse contains TNF_2 domain (60-190 a.a) and transmembrane helix, belonging to the tumor necrosis factor (TNF) family. CD70 (CD27 Ligand) belongs to the tumor necrosis factor (TNF) family, is the ligand for TNFRSF27/CD27.CD70 and CD27 are homotrimer type II and homodimer type I transmembrane glycoprotein, expressing on activated and resting T and B lymphocytes, respectively. As for a wildly use of CD70 in animal disease model, the sequence of amino acids in mouse is very different from human (56.25%) and rat (77.20%).CD70 as one of the most frequently mutated genes in a series of diffuse large B cell lymphomas, especially acts in a crucial Epstein-Barr virus (EBV)-specific T cell immunity and more generally for the immune surveillance of B cells. CD70 inhibits EBV infection by restoring the expansion of EBV-specific T lymphocytes stimulated by the CD70-deficient EBV-infected B cells.CD70 involves in activation of innate and adaptive immunity, expressing in the mature dendritic cells and being up-regulated upon the triggering of CD40 or Toll-like receptors.CD70 induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation.CD70 is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. targeting CD70 positive tumors with CAR-T cells induces a potent antitumor response.
Source: HEK293 cells
Tag: N-his
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: EHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQR
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only