WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse VEGF-A/VEGF164 Protein - RP01060

Recombinant Mouse VEGF-A/VEGF164 Protein - RP01060

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Mouse VEGF-A/VEGF164 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01060-10, RP01060-20, RP01060-50, RP01060-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Mouse VEGF-A/VEGF164 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala27-Arg190) of mouse VEGF 164 (Accession #NP_001273986.1.) fused with a 6×His tag at the N-terminus.

Alternate Names: MVCD1, VEGFA, VEGF, VPF, VEGFA (164)

SWISS: Q00731-2

GeneID: 22339

Species: Mouse

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Bio-Activity: 1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse VEGF164 at 1 μg/mL (100 μL/well) can bind Recombinant Human VEGFR2 with a linear range of 8-30 ng/mL.|2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC). The ED50 for this effect is typically 0.006-0.022 ng/mL, corresponding to a specific activity of 4.54×10^7-1.67×10^8 units/mg.

Source: HEK293 cells

Tag: N-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.

Antigen Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only