Recombinant Rat CCL2/MCP-1 Protein
Sizes: 20ug, 50ug, 100ug
Catalogue Numbers: RP01073-20, RP01073-50, RP01073-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat CCL2/MCP-1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Asn148) of rat CCL2/JE/MCP-1 (Accession #NP_113718.1.) fused with a 6×His tag at the C-terminus.
Alternate Names: C-C motif chemokine ligand 2, CCL2, GDCF-2, HC11, HSMCR30, MCAF, Mcp1, MCP-1, SCYA2, SMC-CF, Ccl2/MCP1
SWISS: P14844
GeneID: 24770
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Source: HEK293 cells
Tag: C-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: QPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTEN
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only