Recombinant Rat CSF-2/GM-CSF Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01207-10, RP01207-20, RP01207-50, RP01207-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat CSF-2/GM-CSF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala18-Lys144) of rat GM-CSF/CSF2 (Accession #NP_446304.1.) fused with a 6×His tag at the N-terminus.
Alternate Names: GMCSF, CSF2
SWISS: P48750
GeneID: 116630
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Bio-Activity: Measured in a cell proliferation assay using SP2/O mouse myeloma cells. The ED50 for this effect is 7.5-30 pg/mL.
Source: HEK293 cells
Tag: N-His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Antigen Sequence: APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only