Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01817-10, RP01817-20, RP01817-50, RP01817-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat IL-1Ra/IL-1F3/IL-1RN Protein is produced by E. coli expression system. The target protein is expressed with sequence (His27-Gln178) of rat IL-1Ra/IL-1F3/IL-1RN (Accession #NP_071530.1) fused with no additional amino acid.
Alternate Names: IL-1ra; il1ra; il-1ra; IL1RA
SWISS: P25086
GeneID: 60582
Species: Rat
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: Interleukin-1 receptor antagonist (IL-1RA) also known as IL1RN is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A), and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. A polymorphism of this protein-encoding gene is reported to be associated with an increased risk of osteoporotic fractures and gastric cancer. IL-1RA/IL1RN may inhibit the activity of IL-1 by binding to its receptor and it has no IL-1 like activity. Genetic variation in IL-1RA/IL1RN is associated with susceptibility to microvascular complications of diabetes type 4 (MVCD4). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in IL-1RA/IL1RN are the cause of interleukin 1 receptor antagonist deficiency (DIRA) which is also known as deficiency of interleukin 1 receptor antagonist. Autoinflammatory diseases manifest inflammation without evidence of infection, high-titer autoantibodies, or autoreactive T-cells. DIRA is a rare, autosomal recessive, genetic autoinflammatory disease that results in sterile multifocal osteomyelitis, and pustulosis from birth.
Bio-Activity: Measured by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 mouse helper T cells. The ED50 for this effect is 2.62-10.48 ng/mL in the presence of 50 pg/mL of rrIL-1 alpha(Catalog: RP01736), corresponding to a specific activity of 9.54×10^4 ~3.82×10^5 units/mg.
Source: E. coli
Tag: NO-tag
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only