WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat IL-3 Protein - RP01789

Recombinant Rat IL-3 Protein - RP01789

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Rat IL-3 Protein Sizes: 10ug, 20g, 50ug, 100ug Catalogue Numbers: RP01789-10, RP01789-20, RP01789-50, RP01789-100 Citations, Manuals and MSDS Available upon request. Description: Recombinant Rat IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Cys169) of rat IL-3 (Accession #NP_113701.1) fused with a 6×His tag at the C-terminus. Alternate Names: IL-3; IL3 SWISS: P97688 GeneID: 24495 Species: Rat Purity: ≥ 95 % as determined by SDS-PAGE. Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week. Background: IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. Bio-Activity: Measured in a cell proliferation assay using NFS60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 2.6‑10.6 ng/mL,corresponding to a specific activity of 9.4×10^4 ~3.85×10^5 units/mg. Source: HEK293 cells Tag: C-His Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Antigen Sequence: ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC Endotoxin: < 0.1 EU/μg of the protein by LAL method. Research Use Only