Recombinant Rat IL-9 Protein
Sizes: 10ug, 20g, 50ug, 100ug
Catalogue Numbers: RP01664-10, RP01664-20, RP01664-50, RP01664-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant Rat IL-9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Ala144) of rat IL-9 (Accession #NP_001099217.1) fused with and a 6×His tag at the C-terminus.
Alternate Names: IL9
SWISS: D4A8I9
GeneID: 116558
Species: Rat
Purity: ≥ 95 % as determined by SDS-PAGE.
Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.
Background: IL-9 is a pleiotropic cytokine that influences various distinct functions of different target cells such as T cells, B cells, mast cells and airway epithelial cells by activating STAT1, STAT3 and STAT5. Because of its pleiotropic functions, IL-9 has been demonstrated to be involved in several diseases, such as cancer, autoimmunity and other pathogen-mediated immune-regulated diseases.
Bio-Activity: Measured in a cell proliferation assay using MC/9-2 mouse mast cells. The ED50 for this effect is 8.02-32.1 ng/mL.
Source: HEK293 cells
Tag: C-6His
Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Antigen Sequence: QRCSTSWGIQHTSYLIENLKDDPSSKCSCSANVTSCLCLPIPSDDCTTPCFQEGMSQVTNATQQSKFSPFFFRVKRIVETLKSNKCQFFSCEKPCNQTTAGNTVSFLKSLLKTFQKTEVQVQRSRA
Endotoxin: < 0.1 EU/μg of the protein by LAL method.
Research Use Only