WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat Leptin/LEP Protein - RP01678

Recombinant Rat Leptin/LEP Protein - RP01678

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Rat Leptin/LEP Protein

Sizes: 50ug, 100ug

Catalogue Number: RP01678-50, RP01678-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of rat LEP (Accession #NP_037208.1) fused with no additional amino acid.

Alternate Names: OB; obese; LEP

SWISS: P50596

GeneID: 25608

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. Animal models have revealed the influence of Leptin in reducing body weight and regulating blood glucose level. When mutations are introduced in obese gene, mice with impaired function of leptin are massively obese and in high risk of diabetes. Leptin deficiency reduces metablic rate. Leptin deficient mice are less active and with lower body temperature than normal animals. Human Leptin shares approximately 84% sequence identity with the mouse protein. Human Leptin consists of 167 amino acid residue including a 21 amino acid residue signal sequence and 146 amino acid residue mature protein sequence.

Bio-Activity: Measured by its binding ability in a functional ELISA.Immobilized Human LEPR (Catalog: RP01248) at 5 μg/mL (100 μL/well) can bind Rat LEP (Catalog: RP01678) with a linear range of 1-530 ng/mL.

Source: E. coli

Tag: NO-tag

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only