WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat Oncostatin-M/OSM Protein - RP01844

Recombinant Rat Oncostatin-M/OSM Protein - RP01844

Regular price
$168.00
Regular price
Sale price
$168.00
Unit price
per 
Availability
Sold out

Recombinant Rat Oncostatin-M/OSM Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01844-10, RP01844-20, RP01844-50, RP01844-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat Oncostatin-M/OSM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys26-Arg208) ofRat Oncostatin-M/OSM (Accession #NP_001006962.1) fused with a His tag at the C-terminus.

Alternate Names: Oncostatin-M, OSM

SWISS: Q65Z15

GeneID: 289747

Species: Rat

Purity: ≥ 95% as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Oncostatin M is also known as OSM, is a glycoprotein belonging to the interleukin-6 family of cytokines that has functions mainly in cell growth. Of these cytokines it most closely resembles leukemia inhibitory factor (LIF) in both structure and function. However, it is as yet poorly defined and is proving important in liver development, haematopoeisis, inflammation and possibly CNS development. It is also associated with bone formation and destruction. OSM signals through cell surface receptors that contain the protein gp130. The type I receptor is composed of gp130 and LIFR, the type II receptor is composed of gp130 and OSMR. Oncostatin M (OSM) was previoustly identified by its ability to inhibit the growth of cells from melanoma and other solid tumors. It also has been reported that OSM, like LIF, IL-6 and G-CSF, has the ability to inhibit the proliferation of murine M1 myeloid leukemic cells and can induce their differentiation into macrophage-like cells.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only