WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat PD-1/PDCD1/CD279 Protein - RP01506

Recombinant Rat PD-1/PDCD1/CD279 Protein - RP01506

Regular price
$196.00
Regular price
Sale price
$196.00
Unit price
per 
Availability
Sold out

Recombinant Rat PD-1/PDCD1/CD279 Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01506-10, RP01506-20, RP01506-50, RP01506-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat PD-1/PDCD1/CD279 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Gln167) of rat PD-1 (Accession #NP_001100397.1) fused with a 6×His tag at the C-terminus.

Alternate Names: CD279, mPD-1, SLEB2, PDCD1, PD1, PDCD1

SWISS: D3ZIN8

GeneID: 301626

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Programmed cell death 1, also known as PDCD1, is a type I transmembrane glycoprotein, and is an immunoreceptor belonging to the CD28/CTLA-4 family negatively regulates antigen receptor signaling by recruiting protein tyrosine phosphatase, SHP-2 upon interacting with either of two ligands, PD-L1 or PD-L2. PD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN-γ by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. PD1 has been suggested to be involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. Furthermore, PD1 is shown to be a regulator of virus-specific CD8+ T cell survival in HIV infection. As a cell surface molecule, PDCD1 regulates the adaptive immune response. Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LEVLNKPWRPLTFSPTWLTVSEGANATFTCSFSNWSEDLKLNWYRLSPSNQTEKQAAFCNGYSQPVRDARFQIVQLPNGHDFHMNILDARRNDSGIYLCGAISLPPKAQIKESPGAELVVTERILETPTRYPRPSPKPEGQFQ

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only