WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rat TNF-alpha Protein - RP01322

Recombinant Rat TNF-alpha Protein - RP01322

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant Rat TNF-alpha Protein

Sizes: 20ug, 50ug, 100ug

Catalogue Numbers: RP01322-20, RP01322-50, RP01322-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant Rat TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of Rat TNFA (Accession #NP_036807.1) fused with an 6×His tag at the C-terminus.

Alternate Names: DIF, TNF-alpha, TNFA, TNFSF2, cachexin, cachectin, TNFα, TNFA

SWISS: P16599

GeneID: 24835

Species: Rat

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: Tumor necrosis factor alpha is a cytokine produced primarily by monocytes and macrophages. It is found in synovial cells and macrophages in the tissues.The primary role of TNFα is in the regulation of immune cells. TNFα is able to induce apoptotic cell death, to induce inflammation, and to inhibit tumorigenesis and viral replication. Dysregulation of TNFα production has been implicated in a variety of human diseases, including major depression, Alzheimer's disease and cancer. Recombinant TNFα is used as an immunostimulant under the INN tasonermin.TNF-alpha is involved in fighting against the tumorigenesis, thus, is regarded as a molecular insight in cancer treatment.

Bio-Activity: Recombinant Rat TNF-alpha induces cytotoxicity in the L-929 Mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 3.37-13.48 pg/mL, corresponding to a specific activity of 7.42×10^7~2.97×10^8 units/mg.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLG GVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only