Recombinant SARS-CoV-2 papain-like protease Protein
Sizes: 10ug, 100ug
Catalogue Number: RP01274LQ-10, RP01274LQ-100
Citations, Manuals and MSDS Available upon request.
Description: Recombinant SARS-CoV-2(2019-nCoV) papain-like protease is produced by E. coli expression system. The target protein is expressed with sequence (Glu1564-Lys1878) of SARS-COV-2(2019-nCoV) papain-like protease (Accession #YP_009725299.1) fused with an initial Met,a 6×His tag at the N-terminus.
Alternate Names: PLPro, PL-PRO, pp1a, Papain-like Protease, Replicase polyprotein 1a, ORF1a polyprotein, Plpro, COVID-19
GeneID: 43740578
Species: SARS-CoV-2
Purity: ≥ 90 % as determined by SDS-PAGE.
Storage: Store at -70℃. This product is stable at ≤ -70℃ for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Source: E. coli
Tag: N-His
Formulation: Supplied as a 0.22 μm filtered solution in 20mM Tris,20% Glycerol,10mM β-Me, pH7.5.Contact us for customized product form or formulation.
Antigen Sequence: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK
Endotoxin: < 1 EU/μg of the protein by LAL method.
Research Use Only