WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant SARS-COV-2 Spike RBD(L452R,T478K) Protein - RP01475

Recombinant SARS-COV-2 Spike RBD(L452R,T478K) Protein - RP01475

Regular price
$210.00
Regular price
Sale price
$210.00
Unit price
per 
Availability
Sold out

Recombinant SARS-COV-2 Spike RBD(L452R,T478K) Protein

Sizes: 10ug, 20g, 50ug, 100ug

Catalogue Numbers: RP01475-10, RP01475-20, RP01475-50, RP01475-100

Citations, Manuals and MSDS Available upon request.

Description: Recombinant SARS-COV-2 Spike RBD(L452R,T478K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg319-Phe541(L452R,T478K) of sars-cov-2 Spike RBD(L452R,T478K) (Accession #YP_009724390.1) fused with a 6×His tag at the C-terminus.

Alternate Names: S1-RBD protein, NCP-CoV RBD Protein, novel coronavirus RBD Protein, 2019-nCoV RBD Protein, S glycoprotein Subunit1 RBD Protein

SWISS: P0DTC2

GeneID: 43740568 (RBD) (L452R,T478K)

Species: SARS-COV-2

Purity: ≥ 95 % as determined by SDS-PAGE.

Storage: Store at -20 ℃. Store the lyophilized protein at -20℃ to -80 ℃ up to 1 year from the date of receipt. After reconstitution, the protein solution is stable at -20℃ for 3 months, at 2-8℃ for up to 1 week.

Background: The spike (S) glycoprotein of coronaviruses contains protrusions that will only bind to certain receptors on the host cell. Known receptors bind S1 are ACE2, angiotensin-converting enzyme 2; DPP4, dipeptidyl peptidase-4; APN, aminopeptidase N; CEACAM, carcinoembryonic antigen-related cell adhesion molecule 1; Sia, sialic acid; O-ac Sia, O-acetylated sialic acid. The spike is essential for both host specificity and viral infectivity. The term ’peplomer‘ is typically used to refer to a grouping of heterologous proteins on the virus surface that function together. The spike (S) glycoprotein of coronaviruses is known to be essential in the binding of the virus to the host cell at the advent of the infection process. It’s been reported that SARS-CoV-2 (COVID-19 coronavirus, 2019-nCoV) can infect the human respiratory epithelial cells through interaction with the human ACE2 receptor. The spike protein is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. The main functions for the Spike protein are summarized as: Mediate receptor binding and membrane fusion; Defines the range of the hosts and specificity of the virus; Main component to bind with the neutralizing antibody; Key target for vaccine design; Can be transmitted between different hosts through gene recombination or mutation of the receptor binding domain (RBD), leading to a higher mortality rate.

Bio-Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2 Spike RBD(L452R,T478K) at 2μg/mL (100μL/well) can bind Human ACE2 (Catalog: RP01275) with a linear range of 0.1-8.96 ng/mL.

Source: HEK293 cells

Tag: C-His

Formulation: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Antigen Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Endotoxin: < 0.1 EU/μg of the protein by LAL method.

Research Use Only