EXT Monoclonal Antibody, (General Species)
Sizes: 100ul, 200ul, 500ul, 1ml, 5ml
Catalogue Numbers: MAV768Ge21-100, MAV768Ge21-200, MAV768Ge21-500, MAV768Ge21-1000, MAV768Ge21-5000
Citations, Manuals and MSDS Available upon request.
Target: Exenatide (EXT)
Alternative Names: Byetta; Bydureon; Exendin-4
Reactivity Species: General Species
UniProt ID: P26349
Category type: Monoclonal Antibody
Collection: Monoclonal Antibodies (Primary Abs)
Concentration: 1mg/mL
Host: Mouse
Potency (Clone Number): C2
Ig Isotype: IgG2a Kappa
Immunogen Catalog Number: CPV768Ge11
Immunogen Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Buffer: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol
State: Liquid
Purification: Protein A + Protein G affinity chromatography
Application: WB; IHC; ICC; IP
Usage: Immunohistochemistry: 5-20µg/mL;
Immunofluorescence:5-20µg/mL;
Optimal working dilutions must be determined by end user.
Storage: Store at 2°C to 8°C for frequent use, -20°C for 12 months
Expiration: Stable for 12 months if correctly stored.
Research Use Only