Recombinant IL-4R, Human
Catalogue Numbers: BK0316-10, BK0316-50
Sizes: 10μg, 50μg
Source: HEK 293
Molecular Weight: 40-45 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 < 70 ng/ml, measured in a neutralization assay using TF-1 cells in the presence of 0.5ng/ml h-IL-4.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDL
WAGQQLLWKGSFKPSEHVKPRAPGNLt VHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPS
LRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Human Interleukin-4 Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-4 Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Interleukin-4 Receptor, also known as IL-4RA and CD124, is a transmembrane glycoprotein belonging to the class I receptor family. It is highly expressed by activated T-cells. IL-4RA couples with γ chain to form the type I receptor for IL-4. The extracellular domain of IL-4RA binds to IL-4 and antagonizes its activity. IL-4RA plays an important role in Th2 cell differentiation, Ig class switching and alternative macrophage activation. It has also been implicated in allergic inflammation, tumor progression and atherogenesis.