WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant IL-6, Human (CHO-expressed) - BK0253

Recombinant IL-6, Human (CHO-expressed) - BK0253

Regular price
$217.41
Regular price
Sale price
$217.41
Unit price
per 
Availability
Sold out

Recombinant IL-6, Human (CHO-expre Ssed)

Catalogue Numbers: BK0253-10, BK0253-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: 21-23 kDa, observed by reducing SDS-PAGE.

Purity: > 95% as analyzed by SDS-PAGE.

Biological Activity: ED50 < 0.06 ng/ml, measured in a cell proliferation assay using 7TD1 cells.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNE
ETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQD
MTTHLILRSFKEFLQSSLRALRQM

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Human Interleukin-6 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-6 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin-6 (IL-6), also known as BSF-2, CDF and IFNB2, is a pleiotropic cytokine that acts in both pro-inflammatory and anti-inflammatory responses. It is produced mainly by T cells, macrophages, monocytes, endothelial cells and muscle cells. IL-6 binds to IL-6 receptor (IL-6R) to trigger the association of IL-6R with gp130, inducing signal transduction through JAKs and STATs. The biological functions of IL-6 are diverse. It stimulates B cell differentiation and antibody production, myeloma and plasmacytoma growth, as well as nerve cell differentiation. It also acts as a myokine, produced by muscle cells in response to muscle contraction, to be released to the blood stream to help break down fats and improve insulin resistance.