Recombinant NOV, Human
Catalogue Numbers: BK0279-10, BK0279-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 20-50 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 < 5 μg/ml, measured in a cell proliferation assay using 3T3 cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCV
FDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRP
EATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSL
KAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELK
TTRGKM
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Human NOV remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human NOV should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Nephroblastoma Overexpressed Gene Protein (NOV), also known as CCN3, IGFBP9 and NOVH, is one of the CCN family of secreted proteins. It is expressed in bone marrow, thymic cells and nephroblastoma. NOV signals through integrin receptors, NOTCH1 and fibulin 1c to regulate multiple cellular activities, such as cell adhesion, migration, proliferation and differentiation. The reported functions of NOV are diverse. It has been reported to play a role in angiogenesis and stem cell self-renewal. It has also been implicated in osteogenic differentiation, embryo development and cancer pathogenesis.