WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Rhe Sus macaque SAA1 (rRhSAA1) - PR5003

Recombinant Rhe Sus macaque SAA1 (rRhSAA1) - PR5003

Regular price
$260.23
Regular price
Sale price
$260.23
Unit price
per 
Availability
Sold out

Recombinant Rhe Sus macaque SAA1 (rRhSAA1)

Catalogue Numbers: PR5003-5, PR5003-20

Sizes: 5µg, 20µg

Source: Escherichia coli

Molecular Weight: Approximately 11.8 kDa, a single non-glycosylated polypeptide chain containing 104 amino acids.

Purity: >97% by SDS-PAGE and HPLC analyses.

Biological Activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/ml, corresponding to a Specific Activity of >1 x 105 IU/mg.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.

AA Sequence: RSWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGG
VWAAEVISDARENIQKLLGRGAEDTLADQAANEWGRSGKDPNHFRPAGLPEKY

Endotoxin: Less than 1EU/mg of rRhSAA1 as determined by LAL method.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE. Made in China

Description: Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein.