Recombinant TRAILR-2, Human
Catalogue Numbers: BK0333-10, BK0333-50
Sizes: 10μg, 50μg
Source: HEK 293
Molecular Weight: ~15 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 < 6 ng/ml, measured in a cell proliferation assay using RPMI-8226 cells in the presence of 25 ng/ml of human TRAIL.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTR
Nt VCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Human TRAIL Receptor-2 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TRAIL Receptor-2 should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: TRAIL Receptor-2 is a cell-surface receptor involved in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced cell-death signaling. The death ligand TRAIL bears high potential as a new anticancer agent, as binding to the death receptors TRAIL-R1 or TRAIL-R2 triggers apoptosis in most cancer cells. TRAIL-R2 is associated with a decrease in the survival rates of breast cancer patients.