Recombinant Human CXCL12 (24-88) protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSH034169-20, PKSH034169-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: CXCL12
Target Symptom: IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1
Target Species: Human
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: P48061
Accession: P48061
Background: Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1α and SDF1β are identical except for the four residues present in the C-terminus of SDF1β but absent from SDF1α. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface; and can also bind syndecan4. SDF1 is known to influence lymphopoiesis; regulate patterning and cell number of neural progenitors; and promote angiogenesis. It also enhances the survival of myeloid progenitor cells.
Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED50 for this effect is < 0.5 ng/mL.
Sequence: MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from a solution containing 20 mM sodium citrate, 0.1 MNaCl, pH 4.5.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 11.49 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only