WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Human Galectin-9 protein(N-His)(active) - PKSH034185
Recombinant Human Galectin-9 protein(N-His)(active) - PKSH034185

Recombinant Human Galectin-9 protein(N-His)(active) - PKSH034185

Regular price
$348.60
Regular price
Sale price
$348.60
Unit price
per 
Availability
Sold out

Recombinant Human Galectin-9 protein(N-His)(active) Sizes: 20μg, 100μg Catalogue Numbers: PKSH034185-20, PKSH034185-100 Citations, Manuals and MSDS Available upon request. Abbreviation: Galectin-9 Target Symptom: LGALS9; HUATA; LGALS9 Target Species: Human Expression Host: E.coli Application: Cell culture; ELISA Fusion Tag: N-His UNIProt ID: A0A024QZ02 Accession: A0A024QZ02 Background: Galectin-9 is a cytoplasmic protein that contains two galectin domains. Galectin-9 is an S-type lectin that is over-expressed in Hodgkin' s disease tissue. Galectin-9 binds galactosides and has high affinity for the Forssman pentasaccharide. Galectin-9 plays a role in thymocyte-epithelial interactions relevant to the biology of the thymus and Inhibits cell proliferation. Galectin-9 is a ligand for HAVCR2/TIM3 and induces T-helper type 1 lymphocyte (Th1) death. In addition, Galectin-9 suppresses tumor cell metastasis by interfering with the associations CD44, VCAM-1, Integrin α4β1. Activity: Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is < 3 μg/mL. Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT Purity: > 98 % as determined by reducing SDS-PAGE. Formulation: Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. Reconstitution: Please refer to the printed manual for detailed information. Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method. Calculated MW: 36.72 kDa Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months. Shipping: This product is provided as lyophilized powder which is shipped with ice packs. Research Use Only