WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Recombinant Mouse CXCL10 protein(N-His)(active) - PKSM041503
Recombinant Mouse CXCL10 protein(N-His)(active) - PKSM041503

Recombinant Mouse CXCL10 protein(N-His)(active) - PKSM041503

Regular price
$348.60
Regular price
Sale price
$348.60
Unit price
per 
Availability
Sold out

Recombinant Mouse CXCL10 protein(N-His)(active)

Sizes: 20μg, 100μg

Catalogue Numbers: PKSM041503-20, PKSM041503-100

Citations, Manuals and MSDS Available upon request.

Abbreviation: CXCL10

Target Symptom: IFNB1; Type I Interferon

Target Species: Mouse

Expression Host: E.coli

Application: Cell culture

Fusion Tag: N-His

UNIProt ID: P17515

Accession: P17515

Background: Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types; such as monocytes; endothelial cells and fibroblasts; in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles; such as chemoattraction for activated T-lymphocytes; inhibition of angiogenesis; and antitumor activity.

Activity: Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 0.2 μg/mL.

Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Purity: > 98 % as determined by reducing SDS-PAGE.

Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.

Reconstitution: Please refer to the printed manual for detailed information.

Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.

Calculated MW: 8.7 kDa

Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.

Shipping: This product is provided as lyophilized powder which is shipped with ice packs.

Research Use Only