Recombinant Mouse IL-36 alpha protein(N-His)(active)
Sizes: 20μg, 100μg
Catalogue Numbers: PKSM041480-20, PKSM041480-100
Citations, Manuals and MSDS Available upon request.
Abbreviation: IL-36 alpha
Target Symptom: MDA-7 (Melanoma Differentiation-Associated gene 7 protein); FISP; St16
Target Species: Mouse
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: Q9JLA2
Accession: Q9JLA2
Background: Human Interleukin-36α (IL-36α) is a secreted cytokine that belongs to the Interleukin 1 cytokine family. IL-36α is expressed in the immune system and the fetal brain, but not in other tissues or multiple hematopoietic cell lines. IL-36α is the only IL-1 family member found to be expressed on T-cells. IL-36α and IL-1F8 are involved in the regulation of adipose tissue gene expression. Importantly, IL-36α inhibits PPARγ expression, which may lead to a reduction in adipocyte differentiation suggesting metabolic effects of this cytokine. IL-36α, along with IL-1F8 and IL-1F9, has been shown to act as an agonist by activating the pathway involving NFκB and MAPK in an IL-1Rrp2 dependent manner. This suggest that IL-36α may signal in a similar fashion to IL-1 and IL-18 in having a binding receptor which upon ligation, recruits a second receptor as a signaling component, forming an active heterodimeric receptor complex.
Activity: Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is < 15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 105IU/mg.
Sequence: MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: < 0.1 EU per μg of the protein as determined by the LAL method.
Calculated MW: 18.84 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only