Recombinant Swine IL-10 protein(N-His)(active)
Sizes: 5μg, 20μg
Catalogue Numbers: PKSS000007-5, PKSS000007-20
Citations, Manuals and MSDS Available upon request.
Abbreviation: IL-10
Target Symptom: B-TCGF; CSIF; TGIF
Target Species: Porcine
Expression Host: E.coli
Application: Cell culture
Fusion Tag: N-His
UNIProt ID: Q29055
Accession: Q29055
Background: IL-10 is a anti-inflammatory cytokine which belongs to the IL-10 family. It is produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types, while it is produced primarily by monocytes and to a lesser extent by lymphocytes. IL-10 is mainly expressed in monocytes and Type 2 T helper cells (TH2), mast cells, CD4+CD25+Foxp3+ regulatory T cells, and also in a certain subset of activated T cells and B cells. IL-10 has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. The importance of interleukin 10 for counteracting excessive immunity in the human body is revealed by the fact that patients with Crohn's disease react favorably towards treatment with bacteria producing recombinant IL-10. IL-10 inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. It also displays a potent ability to suppress the antigen-presentation capacity of antigen presenting cells. However, it is also stimulatory towards certain T cells and mast cells and stimulates B cell maturation and antibody production.
Activity: Measure by its ability to induce proliferation in MC/9‑2 cells. The ED50 for this effect is < 5 ng/mL.
Sequence: MPSSALLYCLIFLAGVAASIKSENSCIHFPTSLPHMLRELRAAFGPVKSFFQTKDQMGDLLLTGSLLEDFKGYLGCQALSEMIQFYLEDVMPKAESDGEDIKEHVNSLGEKLKTLRLRLRRCHQFLPCENKSKAVEEVKSAFSKLQERGVYKAMGEFDIFINYIEAYMTMKMRKN
Purity: > 98 % as determined by reducing SDS-PAGE.
Formulation: Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Reconstitution: Please refer to the printed manual for detailed information.
Endotoxin: Please contact us for more information.
Calculated MW: 20.76 kDa
Storage: Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Shipping: This product is provided as lyophilized powder which is shipped with ice packs.
Research Use Only