WE DO NOT SHIP TO RESIDENTIAL ADDRESSES. For pricing in CAD/AUD/NZD please contact us.

Anti - imipenemase Metallo - β - lactamase (IMP), Rabbit mAb - MB67276

Anti - imipenemase Metallo - β - lactamase (IMP), Rabbit mAb - MB67276

Regular price
$424.94
Regular price
Sale price
$424.94
Unit price
per 
Availability
Sold out

Anti-imipenemase Metallo-β-lactamase (IMP), Rabbit mAb

Sizes: 50µl, 100µl

Catalogue Numbers: MB67276-50, MB67276-100

Swiss-Prot: HAS1313528.1

Host: 293F

Reactivity: IMP-H9

Applications: WB, ELISA

All Applications: WB: 1:500~1:2000
ELISA: 1:5000~10000

Background: Rabbit IgG1, Kappa

Product: 1mg/ml in PBS, pH7.4

Purification and Purity: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Specificity: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by IMP protein. Screening the library with recombinant IMP protein, the target antibody was obtained and then was purified by recombinant and expression.

Extra Notes: By using Indirect ELISA to detect the binding activity of IMP rabbit monoclonal antibody and recombinant IMP protein. Antigen concentration was 1 µ g/ml.

Note: For research use only, not for use in diagnostic procedure.

Immunogen: MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKPYGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSNHHHHHH

Conjugate: Unconjugated

Modification: Unmodified