Recombinant G-CSF, Mouse
Catalogue Numbers: BK0207-10, BK0207-50
Sizes: 10μg, 50μg
Source: CHO
Molecular Weight: 22-24 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE and HPLC.
Biological Activity: ED50 <0.02ng/ml, measured in a cell proliferation assay using NFS-60 cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: VPLVt VSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQC
LSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPt VQPTQSAMPAFTSAFQRRAGGVLAI
SYLQGFLETARLALHHLA
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant murine G-CSF remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, murine G-CSF should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Granulocyte Colony-Stimulating Factor (G-CSF), also known as CSF-3 and MGI-1G, is a cytokine and hormone belonging to the IL-6 superfamily. It is expressed by monocytes, macrophages, endothelial cells, fibroblasts and bone marrow stroma. G-CSF stimulates the bone marrow to produce granulocytes and stem cells, and specifically stimulates the proliferation and differentiation of the neutrophilic granulocyte lineage. G-CSF has been used to stimulate white blood cell production after chemotherapy. It has also been used to boost the number of hematopoietic stem cells after bone marrow transplantation.