🍁100% Proudly Canadian🍁For pricing in CAD/AUD/NZD please contact us.

Recombinant IL-8/CXCL8 (8-79aa), Human (CHO-expressed) - BK0258

Recombinant IL-8/CXCL8 (8-79aa), Human (CHO-expressed) - BK0258

Regular price
$183.53 USD
Regular price
Sale price
$183.53 USD
Unit price
per 
Availability
Sold out
 More payment options

Recombinant IL-8/CXCL8 (8-79aa), Human (CHO-expre Ssed)

Catalogue Numbers: BK0258-10, BK0258-50

Sizes: 10μg, 50μg

Source: CHO

Molecular Weight: ~9 kDa, observed by reducing SDS-PAGE

Purity: > 95% as analyzed by SDS-PAGE and HPLC.

Biological Activity: ED50 < 6 ng/ml, measured in a calcium flux assay using CHO/Gα15 cells transiently expressing CXCR1.

Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation: Lyophilized after extensive dialysis against PBS.

AA Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Endotoxin: < 0.2 EU/μg, determined by LAL method.

Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.

Storage: Lyophilized recombinant Human Interleukin-8 remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-8 should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.

Description: Interleukin-8 (IL-8), also known as CXCL8, GCP-1 and NAP-1, is a proinflammatory chemokine belonging to the intercrine alpha (chemokine CXC) family. It is secreted by monocytes, macrophages and endothelial cells. IL-8 signals through CXCR1 and CXCR2 to chemoattract neutrophils, basophils, and T cells. IL-8 is also a potent promoter of angiogenesis. Other functions of this protein, such as involvement in bronchiolitis pathogenesis, have also been reported.