Recombinant SCF, Rat(HEK293-expre Ssed)
Catalogue Numbers: BK0330-10, BK0330-50
Sizes: 10μg, 50μg
Source: HEK 293
Molecular Weight: 10~20 kDa, observed by reducing SDS-PAGE.
Purity: > 95% as analyzed by SDS-PAGE.
Biological Activity: ED50 < 50 ng/ml, measured in a proliferation assay using TF-1 Cells.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized after extensive dialysis against PBS.
AA Sequence: QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLG
KIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFML
PPVA
Endotoxin: < 0.2 EU/μg, determined by LAL method.
Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/ml.
Storage: Lyophilized recombinant Rat Stem Cell Factor (SCF) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Rat Stem Cell Factor (SCF) should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Usage: This material is offered by USA Bioworld biotech for research, laboratory or further evaluation purposes. For research use only.
Description: Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.